PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G1847
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 192aa    MW: 22206.9 Da    PI: 6.6835
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G1847genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.51.4e-1353111563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  ++ +r+++NRe+ArrsR RK++ ++eL   v +L + N +   +++  ++++ ++++e+
  Gh_A06G1847  53 RKRKRMESNRESARRSRMRKQKHLDELMAQVTQLVKDNNQILTTINFTTQHYINMEAEN 111
                  6789*****************************************99999999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.1E-104598No hitNo description
SMARTSM003386.1E-1946113IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.26651114IPR004827Basic-leucine zipper domain
PfamPF001704.9E-1153111IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.24E-1253107No hitNo description
CDDcd147024.87E-1954104No hitNo description
PROSITE patternPS0003605671IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MSPVVSEILR SGFMINSSLR RRTHLVQSFS VVFLYCGNSM SNSVSEEDLH NQRKRKRMES  60
NRESARRSRM RKQKHLDELM AQVTQLVKDN NQILTTINFT TQHYINMEAE NSVLRAQMME  120
LSQRLESLNE ILNYLNSGTN SNNSNDGFET SEGFETTSDE SFTTIISNHN NNPFVIMNQP  180
IIASSDMMMF QY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15273RKRKRMESNRESARRSRMRKQK
26572RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.56300.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449215.11e-109PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A0D2U3U91e-137A0A0D2U3U9_G
STRINGPOPTR_0005s25290.11e-51(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.13e-39basic leucine-zipper 44